cobot-io-0.1.5.1: test/FASTASpec.hs
{-# LANGUAGE OverloadedStrings #-}
module FASTASpec where
import Bio.FASTA (fastaP, fromFile, toFile)
import Bio.FASTA.Parser (parseOnly)
import Bio.FASTA.Type (Fasta, FastaItem (..))
import Bio.Sequence (bareSequence)
import Control.Monad.IO.Class (liftIO)
import Data.Text.IO (readFile)
import Prelude hiding (readFile, writeFile)
import System.Directory (removeFile)
import Test.Hspec
correctFasta1 :: Fasta Char
correctFasta1 = [ FastaItem "3HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")
, FastaItem "7HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")
, FastaItem "With_spaces" (bareSequence "MDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVRRQRERMDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVRRQRERMDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVRRQRER")
, FastaItem "Empty_ha_ha_ha" (bareSequence "")
]
badFasta2 :: Either String (Fasta Char)
badFasta2 = Left "input.fasta:2:5:\n |\n2 | ACGT....TCG\r\n | ^^\nunexpected \"..\"\nexpecting end of input, end of line, or letter\n"
correctFasta3 :: Fasta Char
correctFasta3 = [ FastaItem "N-His-E4Orf6-7-R2(115)" (bareSequence "TGATGGTGATGGTGATGcatGTGGTAAACTCGACTTTCACTTTTCTCTATCACTGATAGGGAGTGGTAAACTCGACTTTCACTTTTCTCTATCACTGATAGGGAaacagtcagcc")
]
badFasta4 :: Either String (Fasta Char)
badFasta4 = Left "input.fasta:5:8:\n |\n5 | HindIII-BFP_F \r\n | ^^\nunexpected \"-B\"\nexpecting end of input, end of line, or letter\n"
correctFasta5 :: Fasta Char
correctFasta5 = [FastaItem "qCHO49 F" (bareSequence "TGGAGAGATGGCTCGAGGTTqCHORTGGTTGCTGGGAATTGAACTC")]
badFasta6 :: Either String (Fasta Char)
badFasta6 = Left "input.fasta:22:1:\n |\n22 | sPA-LoxP-NheI_R \r\n | ^\nunexpected 's'\nexpecting '>' or end of input\n"
badFasta7 :: Either String (Fasta Char)
badFasta7 = Left "input.fasta:2:1:\n |\n2 | 5\8217-CTTCAAGAGAGAGACCTGCGT-3\8217\r\n | ^\nunexpected '5'\nexpecting '>', end of input, end of line, or sequence\n"
badFasta8 :: Either String (Fasta Char)
badFasta8 = Left "input.fasta:21:5:\n |\n21 | CMV + enhMCK + prcTnT-2\r\n | ^^\nunexpected \"+ \"\nexpecting end of input, end of line, or letter\n"
fastaSpec :: Spec
fastaSpec = describe "Fasta files parser." $ do
parseFile "test/FASTA/order1.fasta" correctFasta1
writeFile "test/FASTA/input.fasta" correctFasta1
parseBadFile "test/FASTA/order2.fasta" badFasta2
parseFile "test/FASTA/order3.fasta" correctFasta3
writeFile "test/FASTA/input.fasta" correctFasta3
parseBadFile "test/FASTA/order4.fasta" badFasta4
parseFile "test/FASTA/order5.fasta" correctFasta5
writeFile "test/FASTA/input.fasta" correctFasta5
parseBadFile "test/FASTA/order6.fasta" badFasta6
parseBadFile "test/FASTA/order7.fasta" badFasta7
parseBadFile "test/FASTA/order8.fasta" badFasta8
parseFile :: FilePath -> Fasta Char -> Spec
parseFile path cf = do
describe "fromFile" $ do
it "correctly parses fasta from file" $ do
fasta <- fromFile path
fasta `shouldBe` cf
parseBadFile :: FilePath -> Either String (Fasta Char) -> Spec
parseBadFile path cf = do
describe "fromFile" $ do
it "correctly parses fasta from file" $ do
res <- liftIO (readFile path)
let badRes = parseOnly fastaP res
badRes `shouldBe` cf
writeFile :: FilePath -> Fasta Char -> Spec
writeFile path cf = describe "writeFile" $ do
it "correctly write fasta into file" $ do
toFile cf path
fasta <- fromFile path
removeFile path
fasta `shouldBe` cf