diff --git a/ChangeLog.md b/ChangeLog.md
--- a/ChangeLog.md
+++ b/ChangeLog.md
@@ -2,6 +2,9 @@
 
 ## [Unreleased]
 
+## [0.1.5.3] - 2023-12-08
+- Update tests and dependencies.
+
 ## [0.1.5.2] - 2023-11-09
 - Add Ord for Fasta and related types.
 
diff --git a/cobot-io.cabal b/cobot-io.cabal
--- a/cobot-io.cabal
+++ b/cobot-io.cabal
@@ -5,7 +5,7 @@
 -- see: https://github.com/sol/hpack
 
 name:           cobot-io
-version:        0.1.5.2
+version:        0.1.5.3
 synopsis:       Biological data file formats and IO
 description:    Please see the README on GitHub at <https://github.com/biocad/cobot-io#readme>
 category:       Bio
@@ -21,6 +21,9 @@
     GHC ==8.10.7
  || ==9.0.2
  || ==9.2.8
+ || ==9.4.8
+ || ==9.6.3
+ || ==9.8.1
 
 extra-source-files:
     README.md
@@ -187,11 +190,11 @@
     , attoparsec >=0.10 && <0.15
     , base >=4.14 && <5
     , binary >=0.8.3.0 && <1.0
-    , bytestring >=0.10.8.1 && <0.12
+    , bytestring >=0.10.8.1 && <0.13
     , cobot >=0.1.1.7
     , containers >=0.5.7.1 && <0.7
     , data-msgpack >=0.0.9 && <0.1
-    , deepseq ==1.4.*
+    , deepseq >=1.4 && <1.6
     , filepath
     , http-conduit ==2.3.*
     , hyraxAbif >=0.2.3.27 && <0.2.5.0
@@ -201,7 +204,7 @@
     , mtl >=2.2.1 && <2.4
     , parser-combinators >=1.2.1
     , split
-    , text >=1.2.2.1 && <2.1
+    , text >=1.2.2.1 && <2.2
     , vector
   default-language: Haskell2010
   if impl(ghc >= 9.0)
@@ -240,24 +243,24 @@
     , attoparsec >=0.10 && <0.15
     , base >=4.14 && <5
     , binary >=0.8.3.0 && <1.0
-    , bytestring >=0.10.8.1 && <0.12
+    , bytestring >=0.10.8.1 && <0.13
     , cobot >=0.1.1.7
     , cobot-io
     , containers >=0.5.7.1 && <0.7
     , data-msgpack >=0.0.9 && <0.1
-    , deepseq ==1.4.*
+    , deepseq >=1.4 && <1.6
     , directory
     , filepath
-    , hspec >=2.4.1 && <2.11
+    , hspec >=2.4.1 && <2.12
     , http-conduit ==2.3.*
     , hyraxAbif >=0.2.3.27 && <0.2.5.0
     , lens >=4.16 && <5.3
     , linear
-    , megaparsec <9.3
+    , megaparsec
     , mtl >=2.2.1 && <2.4
     , neat-interpolation >=0.3
     , parser-combinators >=1.2.1
     , split
-    , text >=1.2.2.1 && <2.1
+    , text >=1.2.2.1 && <2.2
     , vector
   default-language: Haskell2010
diff --git a/src/Bio/Uniprot/Parser.hs b/src/Bio/Uniprot/Parser.hs
--- a/src/Bio/Uniprot/Parser.hs
+++ b/src/Bio/Uniprot/Parser.hs
@@ -1,3 +1,4 @@
+{-# LANGUAGE CPP #-}
 {-# LANGUAGE TupleSections #-}
 {-# OPTIONS_GHC -fno-warn-unused-do-bind #-}
 {-# OPTIONS_GHC -fno-warn-name-shadowing #-}
@@ -9,8 +10,13 @@
 import           Prelude              hiding (null)
 import qualified Prelude              as P (concat, init, last, null, tail)
 
-import           Bio.Uniprot.Type
+#if MIN_VERSION_base(4, 18, 0)
+import           Control.Applicative  ((<|>))
+#else
 import           Control.Applicative  (liftA2, (<|>))
+#endif
+
+import           Bio.Uniprot.Type
 import           Control.Monad        (unless)
 import           Data.Attoparsec.Text
 import           Data.Bifunctor       (second)
diff --git a/test/FASTASpec.hs b/test/FASTASpec.hs
--- a/test/FASTASpec.hs
+++ b/test/FASTASpec.hs
@@ -2,16 +2,19 @@
 
 module FASTASpec where
 
-import Bio.FASTA              (fastaP, fromFile, toFile)
-import Bio.FASTA.Parser       (parseOnly)
-import Bio.FASTA.Type         (Fasta, FastaItem (..))
-import Bio.Sequence           (bareSequence)
-import Control.Monad.IO.Class (liftIO)
-import Data.Text.IO           (readFile)
-import Prelude                hiding (readFile, writeFile)
-import System.Directory       (removeFile)
-import Test.Hspec
+import           Control.Monad.IO.Class (liftIO)
+import           Data.Bifunctor         (first)
+import qualified Data.Text              as T
+import           Data.Text.IO           (readFile)
+import           Prelude                hiding (readFile, writeFile)
+import           System.Directory       (removeFile)
+import           Test.Hspec
 
+import Bio.FASTA        (fastaP, fromFile, toFile)
+import Bio.FASTA.Parser (parseOnly)
+import Bio.FASTA.Type   (Fasta, FastaItem (..))
+import Bio.Sequence     (bareSequence)
+
 correctFasta1 :: Fasta Char
 correctFasta1 = [ FastaItem "3HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")
                 , FastaItem "7HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")
@@ -70,7 +73,7 @@
     it ("correctly parses bad fasta from file " <> path) $ do
         res <- liftIO (readFile path)
         let badRes = parseOnly fastaP res
-        badRes `shouldBe` cf
+        noSpaces badRes `shouldBe` noSpaces cf
 
 writeFile :: FilePath -> Fasta Char -> Spec
 writeFile path cf =
@@ -79,3 +82,7 @@
         fasta <- fromFile path
         removeFile path
         fasta `shouldBe` cf
+
+-- | megaparsec >= 9.3 added more spaces to error messages, so that our old ones do not match.
+noSpaces :: Either String a -> Either String a
+noSpaces = first $ T.unpack . T.replace " " "" . T.pack