diff --git a/ChangeLog.md b/ChangeLog.md
--- a/ChangeLog.md
+++ b/ChangeLog.md
@@ -2,6 +2,10 @@
 
 ## [Unreleased]
 
+## [0.1.2.5] - 2019-12-24
+### Fixed
+- Possibility to have spaces in Fasta sequences.
+
 ## [0.1.2.4] - 2019-12-23
 ### Added
 - Preprocessing for pdb-files.
diff --git a/cobot-io.cabal b/cobot-io.cabal
--- a/cobot-io.cabal
+++ b/cobot-io.cabal
@@ -4,10 +4,10 @@
 --
 -- see: https://github.com/sol/hpack
 --
--- hash: 1ecc108258e91fab1cf40b3e7a3dbb217465d2d0d4b32b76560469f2cf1ca543
+-- hash: 0e861a80d499c39e6ac8b1c1cb2b2fbcb63c09cd506f31744cbba112b69d71c5
 
 name:           cobot-io
-version:        0.1.2.4
+version:        0.1.2.5
 synopsis:       Biological data file formats and IO
 description:    Please see the README on GitHub at <https://github.com/less-wrong/cobot-io#readme>
 category:       Bio
diff --git a/src/Bio/FASTA/Parser.hs b/src/Bio/FASTA/Parser.hs
--- a/src/Bio/FASTA/Parser.hs
+++ b/src/Bio/FASTA/Parser.hs
@@ -2,12 +2,13 @@
   ( fastaP
   ) where
 
-import           Bio.FASTA.Type         (Fasta, FastaItem(..))
-import           Bio.Sequence           (BareSequence, bareSequence)
-import           Data.Attoparsec.Text   (Parser, many', many1', char, endOfLine, letter,
-                                            takeWhile, choice, endOfInput)
-import           Data.Text              (Text, strip)
-import           Prelude         hiding (takeWhile)
+import           Bio.FASTA.Type       (Fasta, FastaItem (..))
+import           Bio.Sequence         (BareSequence, bareSequence)
+import           Data.Attoparsec.Text (Parser, char, choice, endOfInput,
+                                       endOfLine, letter, many', many1',
+                                       takeWhile)
+import           Data.Text            (Text, strip)
+import           Prelude              hiding (takeWhile)
 
 -- | Parser of .fasta file.
 --
@@ -23,8 +24,8 @@
 fastaSeq :: Parser (BareSequence Char)
 fastaSeq = bareSequence . mconcat <$> many' line
 
-line :: Parser (String)
-line = many1' letter <* eol
+line :: Parser String
+line = concat <$> many1' (many1' letter <* many' (char ' ')) <* eol
 
 eol :: Parser ()
 eol = tabs *> choice [slashN, endOfInput]
diff --git a/src/Bio/FASTA/Type.hs b/src/Bio/FASTA/Type.hs
--- a/src/Bio/FASTA/Type.hs
+++ b/src/Bio/FASTA/Type.hs
@@ -7,7 +7,8 @@
 import           Data.Text    (Text)
 
 -- | Type alias for FASTA file.
---  satisfies the following format : >(\s|\t)*[^\n\r]+(\s|\t)*(\n|\r)*(\w(\n|\r)*)*
+--  satisfies the following format : >(\s|\t)*[^\n\r]+(\s|\t)*(\n|\r)*((\w|\s)(\n|\r)*)*
+--
 type Fasta a = [FastaItem a]
 
 -- | One record in FASTA file.
diff --git a/test/FASTASpec.hs b/test/FASTASpec.hs
--- a/test/FASTASpec.hs
+++ b/test/FASTASpec.hs
@@ -10,7 +10,11 @@
 import           Test.Hspec
 
 correctFasta :: Fasta Char
-correctFasta = [FastaItem "3HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL"), FastaItem "7HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")]
+correctFasta = [ FastaItem "3HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")
+               , FastaItem "7HMX:A|PDBID|CHAIN|SEQUENCE" (bareSequence "EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL")
+               , FastaItem "With_spaces" (bareSequence "MDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVRRQRERMDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVRRQRERMDFFDLDIEIKQERLPAECSLNSPLNYSLSAQLTDRMTPRTENVRRQRER")
+               , FastaItem "Empty_ha_ha_ha" (bareSequence "")
+               ]
 
 fastaSpec :: Spec
 fastaSpec = describe "Fasta file parser." $ do